PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI11G11920.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 288aa    MW: 30920.5 Da    PI: 8.3115
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI11G11920.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP114.36.8e-36391051278
                      TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      s++++yhrrhkvCe+h+k+pvv+v+g+eqrfCqqCsrfh+l efD++k+sCr+rL++hn+rrrk+q+
  OMERI11G11920.2  39 SRCRDYHRRHKVCEAHAKTPVVVVAGQEQRFCQQCSRFHNLAEFDDGKKSCRKRLDGHNRRRRKPQH 105
                      689*************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114127.01726103IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.02E-3239107IPR004333Transcription factor, SBP-box
PfamPF031103.1E-2739102IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.3E-263990IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEWAAAATKA ASWGMAVAAA AADDAGPTML SFAGPSSSSR CRDYHRRHKV CEAHAKTPVV  60
VVAGQEQRFC QQCSRFHNLA EFDDGKKSCR KRLDGHNRRR RKPQHDALNP RSFLPYHQAN  120
QFSVYPQTFP IADQSADALM RPLDRHPPFS ISFSGTFREP KQFPFLQDGG SGLGAARHDL  180
LRPFSSPEDG ANITTTRSAC NGVPHGLDPE CALSLLSSSL HPSPAAGISS ATAPPQFAPS  240
SFSRIAASSQ AVTTAFASDG GSVAGDHVLV PAVTYEDPSQ AMPFSWQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-24441022684squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
185102KKSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336080.0AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355690.0AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617950.11e-176PREDICTED: putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-178SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0E0F6000.0A0A0E0F600_9ORYZ; Uncharacterized protein
STRINGORGLA11G0121600.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-35SBP family protein